PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G22390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 235aa    MW: 24829.3 Da    PI: 10.4909
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G22390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.92.3e-25139183145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
  OGLUM04G22390.1 139 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPMEA 183
                      69***************************************9987 PP

2QLQ552.5e-1974110137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  OGLUM04G22390.1  74 SALTFMQRQELEHQVLIYRYFAAGAPVPVHLVLPIWK 110
                      799*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.2E-674110IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.43375110IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.5E-1175109IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.072139183IPR014977WRC domain
PfamPF088799.3E-21140181IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MLAEGRQAYS PPPPPPSKLP RLSGTDPTDG VVTMAAPSPL VLGLGLGLGG SGSDRSGSDA  60
EASAATVREA RPPSALTFMQ RQELEHQVLI YRYFAAGAPV PVHLVLPIWK SIAAASSFGP  120
QSFPSLTGSL CFDYRSSMEP EPGRCRRTDG KKWRCSRDVV PGHKYCERHV HRGRGRSRKP  180
MEASAAVAPT SLPVRPALHT VATLATSAPS PSHLGFSSAS KVLLAHTTTG TTRAT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172180GRGRSRKPM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1109340.0AK110934.1 Oryza sativa Japonica Group cDNA clone:002-173-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635359.11e-132PREDICTED: growth-regulating factor 12
SwissprotQ6AWX71e-133GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLA0A0D9ZPJ51e-168A0A0D9ZPJ5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA016961-PA1e-133(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.12e-37growth-regulating factor 4